PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00101.1.g00230.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 406aa    MW: 42926.9 Da    PI: 10.0995
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00101.1.g00230.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.12.5e-35172232262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   ++ al+cprC++++tkfCyynny++ qPry+CkaC+ryWt+GG+ rn+PvGg++rk++k+s
  Zjn_sc00101.1.g00230.1.am.mk 172 PDVALACPRCNAMETKFCYYNNYNMLQPRYLCKACKRYWTHGGSQRNIPVGGASRKQNKRS 232
                                   567899**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-21169231IPR003851Zinc finger, Dof-type
PfamPF027014.1E-30175230IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.767176230IPR003851Zinc finger, Dof-type
PROSITE patternPS013610178214IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MDADVICTSI MPGDMWGPAS RGPTYQCPLY TRVTSRYLCS PLTLTVARPT TFLFVVSRCA  60
NFTLFLRTAR AVLSPFFSLS SHLAAPNIKW KGALSPSVAL SIPTLLQSSS DEIKGTLVPE  120
KMTNSKKSNT SAGASSAHSN NIQQEARDMR QARAARQQAA ANVGERRPRP QPDVALACPR  180
CNAMETKFCY YNNYNMLQPR YLCKACKRYW THGGSQRNIP VGGASRKQNK RSSASSSLPA  240
AAASSSSVIN KELQQQLLPA APMIEAAADF SNVFPSFMPT GFEHHSNQLP FSPAPAPLPL  300
PTLLPPVPML APDAGTPSFL DMLRGGFLDY QTNGFYAPAT ASSGMEALPF GPGVQPGVAG  360
VLQGGVAAPT GGRVDATAAG QGAAWPKPQV RGNQQGGAGA PGNGRA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980592.12e-46PREDICTED: dof zinc finger protein PBF-like
SwissprotO244632e-44PBF_MAIZE; Dof zinc finger protein PBF
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2247437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-29Dof family protein